PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v2309890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family LBD
Protein Properties Length: 203aa    MW: 22258.2 Da    PI: 5.2074
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v2309890.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.59.7e-43361351100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++kll++lpe++r da++s+vyeA ar+rdPvyG++g i +lq+q+++l+a+l
  Lj3g3v2309890.1  36 PCAACKILRRRCADKCVLAPYFPPTDPAKFTIAHRVFGASNIIKLLQELPESQRVDAVTSMVYEASARIRDPVYGCAGAICQLQKQVNELQAQL 129
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a+ ++e
  Lj3g3v2309890.1 130 AKSQAE 135
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.15335136IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-4236133IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MDNSNGSDTH NNPTSLSHSP TNSSSSSQLP QVVMSPCAAC KILRRRCADK CVLAPYFPPT  60
DPAKFTIAHR VFGASNIIKL LQELPESQRV DAVTSMVYEA SARIRDPVYG CAGAICQLQK  120
QVNELQAQLA KSQAEIVNMQ LQQANLVARI CMEMAPPNPQ ESESPQQSVG DFFISSPPQS  180
IGYGMNFLEE NTSLNTLWEP LWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0066420.0AP006642.1 Lotus japonicus genomic DNA, chromosome 3, clone: LjT34I09, TM0246c, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003538040.11e-100PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9SK084e-77LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0B2QKT81e-100A0A0B2QKT8_GLYSO; LOB domain-containing protein 1
TrEMBLI1LKC51e-100I1LKC5_SOYBN; Uncharacterized protein
STRINGGLYMA11G15810.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.13e-72LOB domain-containing protein 11